-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LEF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-132 of human LEF1 (NP_057353.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against LEF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-132 of human LEF1 (NP_057353.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-12204A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LEF1 |
| Target Synonyms | LEF-1; TCF10; TCF7L3; TCF1ALPHA; LEF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Jurkat, Mouse thymus, Rat testis | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-132 of human LEF1 (NP_057353.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLS | Uniprot ID | Q9UJU2 |
Uniprot Id
Q9UJU2
Target Species
Human
Target Name
LEF1
Target Full Name
Lymphoid enhancer-binding factor 1
Target Function
Transcription factor that binds DNA in a sequence-specific manner. Participates in the Wnt signaling pathway. Activates transcription of target genes in the presence of CTNNB1 and EP300. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Regulates T-cell receptor alpha enhancer function. Required for IL17A expressing gamma-delta T-cell maturation and development, via binding to regulator loci of BLK to modulate expression. May play a role in hair cell differentiation and follicle morphogenesis.; Transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.; Lacks the CTNNB1 interaction domain and may therefore be an antagonist for Wnt signaling.; Transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells.
Target Subcellular Location
Nucleus.
Target Protein Families
TCF/LEF family
Target Tissue Specificity
Detected in thymus. Not detected in normal colon, but highly expressed in colon cancer biopsies and colon cancer cell lines. Expressed in several pancreatic tumors and weakly expressed in normal pancreatic tissue. Isoforms 1 and 5 are detected in several
Target Synonyms
DKFZp586H0919; FLJ46390; LEF 1; LEF-1; Lef1; LEF1_HUMAN; Lymphoid enhancer binding factor 1 ; Lymphoid enhancer-binding factor 1; T cell specific transcription factor 1 alpha; T cell-specific transcription factor 1-alpha; TCF 1 alpha; TCF1 alpha; TCF1-alpha; TCF10; TCF1alpha ; TCF7L3; Transcription factor T cell specific 1 alpha
Target Background
This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants.
Notification