-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDIA6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDIA6 (NP_005733.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PDIA6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDIA6 (NP_005733.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13845A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDIA6 |
| Target Synonyms | P5; ERP5; TXNDC7; PDIA6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDIA6 (NP_005733.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPT | Uniprot ID | Q15084 |
Uniprot Id
Q15084
Target Species
Human
Target Name
PDIA6
Target Full Name
Protein disulfide-isomerase A6
Target Function
May function as a chaperone that inhibits aggregation of misfolded proteins. Negatively regulates the unfolded protein response (UPR) through binding to UPR sensors such as ERN1, which in turn inactivates ERN1 signaling. May also regulate the UPR via the EIF2AK3 UPR sensor. Plays a role in platelet aggregation and activation by agonists such as convulxin, collagen and thrombin.
Target Subcellular Location
Endoplasmic reticulum lumen. Cell membrane. Melanosome.
Target Protein Families
Protein disulfide isomerase family
Target Tissue Specificity
Expressed in platelets (at protein level).
Target Synonyms
Endoplasmic reticulum protein 5; ER protein 5; ERp5; P5; Pdia6; PDIA6_HUMAN; Protein disulfide isomerase A6; Protein disulfide isomerase associated 6; Protein disulfide isomerase family A member 6; Protein disulfide isomerase P5; Protein disulfide isomerase related protein; Protein disulfide-isomerase A6; Thioredoxin domain containing 7 (protein disulfide isomerase); Thioredoxin domain containing protein 7 ; Thioredoxin domain-containing protein 7; TXNDC7
Target Background
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. This protein inhibits the aggregation of misfolded proteins and exhibits both isomerase and chaperone activity. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification