Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPA14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPA14 (Q0VDF9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HSPA14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPA14 (Q0VDF9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14127A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPA14 |
| Target Synonyms | HSP70-4; HSP70L1; MSANTD7; HSPA14 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPA14 (Q0VDF9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRY | Uniprot ID | Q0VDF9 |
Uniprot Id
Q0VDF9
Target Species
Human
Target Name
HSPA14
Target Full Name
Heat shock 70 kDa protein 14
Target Function
Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Heat shock protein 70 family
Target Synonyms
Heat shock 70 kDa protein 14; Heat shock 70kDa protein 14; Heat shock protein HSP60; Heat shock protein hsp70 related protein; HSP60; HSP70 4; HSP70 like protein 1; HSP70-like protein 1; HSP70L1; HSP7E_HUMAN; HSPA 14; HSPA14; MGC131990
Target Background
Predicted to enable several functions, including ATP binding activity; misfolded protein binding activity; and unfolded protein binding activity. Predicted to be involved in several processes, including cellular response to unfolded protein; chaperone cofactor-dependent protein refolding; and protein refolding. Located in cytosol. Colocalizes with ribosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
