Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX9 (P55771) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PAX9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX9 (P55771) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14289A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX9 |
| Target Synonyms | STHAG3; PAX9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach, Mouse thymus, PC-3, Rat lung, Rat stomach | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX9 (P55771). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAW | Uniprot ID | P55771 |
Uniprot Id
P55771
Target Species
Human
Target Name
PAX9
Target Full Name
Paired box protein Pax-9
Target Function
Transcription factor required for normal development of thymus, parathyroid glands, ultimobranchial bodies, teeth, skeletal elements of skull and larynx as well as distal limbs.
Target Involvement
Tooth agenesis, selective, 3 (STHAG3)
Target Subcellular Location
Nucleus.
Target Synonyms
Paired box 9; Paired box gene 9; Paired box homeotic gene 9; Paired box protein 9; Paired box protein Pax 9; Paired box protein Pax-9; Paired box protein Pax9; Paired domain gene 9; PAX 9; PAX9; PAX9_HUMAN; STHAG3
Target Background
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. Mice lacking this gene exhibit impaired development of organs, musculature and the skeleton, including absent and abnormally developed teeth, and neonatal lethality. Mutations in the human gene are associated with selective tooth agenesis-3.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
