-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHX10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 262-361 of human CHX10 (P58304) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHX10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 262-361 of human CHX10 (P58304) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14292A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHX10 |
| Target Synonyms | RET1; CHX10; HOX10; MCOP2; MCOPCB3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse spinal cord, Rat spinal cord | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 262-361 of human CHX10 (P58304). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA | Uniprot ID | P58304 |
Uniprot Id
P58304
Target Species
Human
Target Name
VSX2
Target Full Name
Visual system homeobox 2
Target Function
Acts as a transcriptional regulator through binding to DNA at the consensus sequence 5'-[TC]TAATT[AG][AG]-3' upstream of gene promoters. Plays a significant role in the specification and morphogenesis of the sensory retina. Mediates differentiation of V2a interneurons by repression of motor neuron gene transcription, via competitively binding to response elements that are activated by the ISL1-LHX3 complex, such as VSX1. Acts as a positive transcriptional regulator of NXNL1; regulation is significantly increased in synergy with VSX1. Acts as a negative transcriptional regulator of MITF. Represses SAG transcription by competitive inhibition of ISL1-LHX3 response elements. Binds to the photoreceptor conserved element-1 (PCE-1) in the promoter of rod photoreceptor arrestin SAG and acts as a transcriptional repressor. Plays a significant role in the specification and morphogenesis of the sensory retina. Involved in the development of retinal ganglion cells (RGCs) which leads to release of SHH by RGCs, promoting Hedgehog signaling and subsequent proliferation of retinal progenitor cells. Participates in the development of the cells of the inner nuclear layer, by promoting postnatal differentiation of bipolar cells with a comparable inhibition of rod cell differentiation. May play a role in the maintenance of neural retina identity during development by regulation of canonical Wnt genes and CTNNB1 localization, suggesting a role in the regulation of canonical Wnt signaling
Target Involvement
Microphthalmia, isolated, 2 (MCOP2); Microphthalmia with cataracts and iris abnormalities (MCOPCTI); Microphthalmia, isolated, with coloboma, 3 (MCOPCB3)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Tissue Specificity
Abundantly expressed in retinal neuroblasts during eye development and in the inner nuclear layer of the adult retina. Within this layer, expression is stronger in the outer margin where bipolar cells predominate.
Target Synonyms
C elegans ceh 10 homeo domain containing homolog; Ceh 10 homeo domain containing homolog (C. elegans); Ceh 10 homeo domain containing homolog; Ceh 10 homeodomain containing homolog; Ceh 10 homeodomain containing homolog (C. elegans); Ceh-10 homeodomain-containing homolog; Ceh10 homeo domain containing homolog; Ceh10 homeodomain containing homolog; CHX 10; Homeobox protein CHX 10; Homeobox protein CHX10; HOX 10; HOX10; MCOP 2; MCOP2; MCOPCB 3; MCOPCB3; RET 1; RET1; Visual system homeobox 2; Vsx 2; Vsx2; VSX2_HUMAN
Notification