-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HoxC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HoxC6 (NP_004494.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HoxC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HoxC6 (NP_004494.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15361A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXC6 |
| Target Synonyms | CP25; HOX3; HOX3C; HHO.C8; HoxC6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HoxC6 (NP_004494.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSI | Uniprot ID | P09630 |
Uniprot Id
P09630
Target Species
Human
Target Name
HOXC6
Target Full Name
Homeobox protein Hox-C6
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family
Target Synonyms
CP25; HHO.C8; Homeo box 3C; Homeo box C6; Homeo box C8 protein; Homeobox C6; Homeobox protein CP25; Homeobox protein HHO.C8; Homeobox protein Hox-3C; Homeobox protein Hox-C6; HOX3; HOX3C; Hoxc6; HXC6_HUMAN
Target Background
This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.
Notification