-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GSTA4 was raised in Rabbit using the recombinant funsion protein containing a sequence corresponding to amino acids 1-100 of human GSTA4 (NP_001503.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GSTA4 was raised in Rabbit using the recombinant funsion protein containing a sequence corresponding to amino acids 1-100 of human GSTA4 (NP_001503.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15365A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GSTA4 |
| Target Synonyms | GTA4; GSTA4-4; GSTA4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Hep G2 | Application | ELISA, WB |
| Immunogen Description | Recombinant funsion protein containing a sequence corresponding to amino acids 1-100 of human GSTA4 (NP_001503.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTL | Uniprot ID | O15217 |
Uniprot Id
O15217
Target Species
Human
Target Name
GSTA4
Target Full Name
Glutathione S-transferase A4
Target Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
Target Subcellular Location
Cytoplasm.
Target Protein Families
GST superfamily, Alpha family
Target Tissue Specificity
Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
Target Research Area
Cell Biology, Metabolism
Target Synonyms
DKFZp686D21185; Glutathione S alkyltransferase A4; Glutathione S aralkyltransferase A4; Glutathione S aryltransferase A4; Glutathione S transferase A4 4; Glutathione S transferase A4; Glutathione S transferase alpha 4 ; Glutathione S-transferase A4; Glutathione S-transferase A4-4; Glutathione transferase A4 4; GST class alpha member 4; GST class-alpha member 4; GSTA4 4; GSTA4; GSTA4_HUMAN; GTA4; OTTHUMP00000016624; OTTHUMP00000016625; S (hydroxyalkyl)glutathione lyase A4
Target Background
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.
Notification