Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSD3B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human HSD3B1 (P14060) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HSD3B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human HSD3B1 (P14060) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16960A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSD3B1 |
| Target Synonyms | HSD3B; HSDB3; HSDB3A; SDR11E1; 3BETAHSD; HSD3B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat ovary | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HSD3B1 (P14060). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAK | Uniprot ID | P14060 |
Uniprot Id
P14060
Target Species
Human
Target Name
HSD3B1
Target Full Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
Target Function
A bifunctional enzyme responsible for the oxidation and isomerization of 3beta-hydroxy-Delta(5)-steroid precursors to 3-oxo-Delta(4)-steroids, an essential step in steroid hormone biosynthesis. Specifically catalyzes the conversion of pregnenolone to progesterone, 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Additionally, catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the bioavalability of the active forms. Specifically converts dihydrotestosterone to its inactive form 5alpha-androstanediol, that does not bind androgen receptor/AR. Also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. Expected to use NAD(+) as preferred electron donor for the 3beta-hydroxy-steroid dehydrogenase activity and NADPH for the 3-ketosteroid reductase activity.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Target Protein Families
3-beta-HSD family
Target Tissue Specificity
Placenta and skin. Predominantly expressed in mammary gland tissue.
Target Synonyms
HSD3B1; 3BH; HSDB3A; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; Delta-5-3-ketosteroid isomerase; Dihydrotestosterone oxidoreductase; Steroid Delta-isomerase; Trophoblast antigen FDO161G
Target Background
The protein encoded by this gene is an enzyme that catalyzes the oxidative conversion of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, which leads to the production of all classes of steroid hormones. The encoded protein also catalyzes the interconversion of 3-beta-hydroxy- and 3-keto-5-alpha-androstane steroids.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
