-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WIPF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human WIPF1 (NP_001070737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against WIPF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human WIPF1 (NP_001070737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00511A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WIPF1 |
| Target Synonyms | WIP; WAS2; PRPL-2; WASPIP; WIPF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, RAW264.7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human WIPF1 (NP_001070737.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPP | Uniprot ID | O43516 |
Uniprot Id
O43516
Target Species
Human
Target Name
WIPF1
Target Full Name
WAS/WASL-interacting protein family member 1
Target Function
Plays a role in the reorganization of the actin cytoskeleton. Contributes with NCK1 and GRB2 in the recruitment and activation of WASL. May participate in regulating the subcellular localization of WASL, resulting in the disassembly of stress fibers in favor of filopodia formation. Plays a role in the formation of cell ruffles. Plays an important role in the intracellular motility of vaccinia virus by functioning as an adapter for recruiting WASL to vaccinia virus.
Target Involvement
Wiskott-Aldrich syndrome 2 (WAS2)
Target Subcellular Location
Cytoplasmic vesicle. Cytoplasm, cytoskeleton. Cell projection, ruffle.
Target Protein Families
Verprolin family
Target Tissue Specificity
Highly expressed in peripheral blood mononuclear cells, spleen, placenta, small intestine, colon and thymus. Lower expression in ovary, heart, brain, lung, liver, skeletal muscle, kidney, pancreas, prostate and testis.
Target Synonyms
WIPF1; WASPIP; WIP; WAS/WASL-interacting protein family member 1; Protein PRPL-2; Wiskott-Aldrich syndrome protein-interacting protein; WASP-interacting protein
Target Background
This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene.
Notification