Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCDC61 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 352-531 of human CCDC61 (NP_001073871.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCDC61 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 352-531 of human CCDC61 (NP_001073871.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01439A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCDC61 |
| Target Synonyms | VFL3; hVFL3; CCDC61 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 352-531 of human CCDC61 (NP_001073871.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSPSPTGGRALRFDPTAFVKAKERKQREIQMKQQQRNRLGSGGSGDGPSVSWSRQTQPPAALTGRGDAPNRSRNRSSSVDSFRSRCSSASSCSDLEDFSESLSRGGHRRRGKPPSPTPWSGSNMKSPPVERSHHQKSLANSGGWVPIKEYSSEHQAADMAEIDARLKALQEYMNRLDMRS | Uniprot ID | Q9Y6R9 |
Uniprot Id
Q9Y6R9
Target Species
Human
Target Name
CCDC61
Target Full Name
Centrosomal protein CCDC61
Target Function
Microtubule-binding centrosomal protein required for centriole cohesion, independently of the centrosome-associated protein/CEP250 and rootletin/CROCC linker. In interphase, required for anchoring microtubule at the mother centriole subdistal appendages and for centrosome positioning. During mitosis, may be involved in spindle assembly and chromatin alignment by regulating the organization of spindle microtubules into a symmetrical structure. Has been proposed to play a role in CEP170 recruitment to centrosomes. However, this function could not be confirmed. Plays a non-essential role in ciliogenesis
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Cytoplasm, cytoskeleton, cilium basal body.
Target Synonyms
CCDC61Coiled-coil domain-containing protein 61
Target Background
Enables identical protein binding activity and microtubule binding activity. Involved in centriole assembly and mitotic spindle assembly. Located in centriolar satellite and ciliary basal body. Part of centriolar subdistal appendage.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
