-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR3A (NP_008986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLR3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR3A (NP_008986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01682A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR3A |
| Target Synonyms | ADDH; C160; HLD7; RPC1; WDRTS; RPC155; hRPC155; POLR3A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR3A (NP_008986.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSNFLQSFETA | Uniprot ID | O14802 |
Uniprot Id
O14802
Target Species
Human
Target Name
POLR3A
Target Full Name
DNA-directed RNA polymerase III subunit RPC1
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Target Involvement
Leukodystrophy, hypomyelinating, 7, with or without oligodontia and/or hypogonadotropic hypogonadism (HLD7)
Target Subcellular Location
Nucleus.
Target Protein Families
RNA polymerase beta' chain family
Target Tissue Specificity
Expressed in the brain, in the cortex and the white matter (at protein level).
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
BC053071; DNA directed RNA polymerase III largest subunit; DNA directed RNA polymerase III subunit A; DNA-directed RNA polymerase III largest subunit; DNA-directed RNA polymerase III subunit A; DNA-directed RNA polymerase III subunit RPC1; hRPC155; MGC62420; POLR 3A; POLR3A; Polymerase (RNA) III (DNA directed) polypeptide A 155kDa; Polymerase (RNA) III (DNA directed) polypeptide A; RGD1305574; RNA polymerase III 155 kDa subunit; RNA polymerase III subunit C1; RNA polymerase III subunit C160; RNA polymerase III subunit RPC155 D; RPC1; RPC1_HUMAN; RPC155
Target Background
The protein encoded by this gene is the catalytic component of RNA polymerase III, which synthesizes small RNAs. The encoded protein also acts as a sensor to detect foreign DNA and trigger an innate immune response.
Notification