Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF302 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 90-200 of human ZNF302 (NP_060913.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF302 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 90-200 of human ZNF302 (NP_060913.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01703A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF302 |
| Target Synonyms | HSD16; MST154; ZNF327; MSTP154; ZNF135L; ZNF140L; ZNF302 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 90-200 of human ZNF302 (NP_060913.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKI | Uniprot ID | Q9NR11 |
Uniprot Id
Q9NR11
Target Species
Human
Target Name
ZNF302
Target Full Name
Zinc finger protein 302
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Synonyms
HSD16; MST154; MSTP154; Zinc finger protein 135-like; Zinc finger protein 140-like; Zinc finger protein 302; Zinc finger protein 327; Zinc finger ZNF140 like; ZN302_HUMAN; ZNF135 like; ZNF135L; ZNF140 like; ZNF140L; ZNF302; ZNF327
Target Background
This gene encodes a member of the zinc-finger protein family. The encoded protein contains seven C2H2-type zinc fingers and a KRAB domain, but its function has yet to be determined. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
