Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHIC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CHIC2 (NP_036242.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CHIC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CHIC2 (NP_036242.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01840A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHIC2 |
| Target Synonyms | BTL; CHIC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CHIC2 (NP_036242.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD | Uniprot ID | Q9UKJ5 |
Uniprot Id
Q9UKJ5
Target Species
Human
Target Name
CHIC2
Target Full Name
Cysteine-rich hydrophobic domain-containing protein 2
Target Involvement
A chromosomal aberration involving CHIC2 is found in a form of acute myeloid leukemia (AML). Translocation t(4;12)(q12;p13) with ETV6.
Target Subcellular Location
Cell membrane. Cytoplasmic vesicle. Note=Also present at a Golgi-like vesicular compartment and at scattered vesicles.
Target Protein Families
CHIC family
Target Research Area
Others
Target Synonyms
BrX-like translocated in leukemia; BTL; Chic2; CHIC2_HUMAN; Cystein-rich hydrophobic domain 2; Cysteine-rich hydrophobic domain 2 protein; MGC21173
Target Background
This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
