Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP2 (NP_001312.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP2 (NP_001312.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02435A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSRP2 |
| Target Synonyms | CRP2; LMO5; SmLIM; CSRP2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 22Rv1, A-549, Mouse liver, Mouse lung, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP2 (NP_001312.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ | Uniprot ID | Q16527 |
Uniprot Id
Q16527
Target Species
Human
Target Name
CSRP2
Target Full Name
Cysteine and glycine-rich protein 2
Target Function
Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Highly expressed in the aorta, but not in heart and skeletal muscle.
Target Synonyms
CRP2; CSRP2; CSRP2_HUMAN; Cysteine and glycine rich protein 2; Cysteine and glycine-rich protein 2; Cysteine rich protein 2; Cysteine-rich protein 2; LIM domain only protein 5; LMO-5; LMO5; SmLIM; Smooth muscle cell LIM protein
Target Background
CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
