Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RLN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-185 of human RLN2 (NP_604390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RLN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-185 of human RLN2 (NP_604390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02767A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RLN2 |
| Target Synonyms | H2; RLXH2; H2-RLX; bA12D24.1.1; bA12D24.1.2; RLN2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-185 of human RLN2 (NP_604390.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC | Uniprot ID | P04090 |
Uniprot Id
P04090
Target Species
Human
Target Name
RLN2
Target Full Name
Prorelaxin H2
Target Function
Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
Target Subcellular Location
Secreted.
Target Protein Families
Insulin family
Target Tissue Specificity
Isoform 1 is expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 is relatively abundant in placenta. It is in much lower abundance in the prostate gland. Not detected in the ovary.
Target Synonyms
H2; REL2_HUMAN; Relaxin 2; Relaxin A chain; Relaxin H2; RLN2; RLXH2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
