Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UPK1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-230 of human UPK1A (NP_008931.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UPK1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-230 of human UPK1A (NP_008931.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03224A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UPK1A |
| Target Synonyms | UP1A; UPIA; UPKA; TSPAN21; UPK1A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-230 of human UPK1A (NP_008931.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SCITSYTHRDYMVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYT | Uniprot ID | O00322 |
Uniprot Id
O00322
Target Species
Human
Target Name
UPK1A
Target Full Name
Uroplakin-1a
Target Function
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Tissue Specificity
High expression restricted to ureteric urothelium (most superficial cells); low expression in prostate. Expression in normal urothelial cells is lost in culture. Some expression in tumor cell lines derived from urothelial malignancies.
Target Synonyms
UPK1A; TSPAN21; Uroplakin-1a; UP1a; Tetraspanin-21; Tspan-21; Uroplakin Ia; UPIa; UPKa
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
