-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTH2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-145 of human PTH2R (NP_005039.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTH2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-145 of human PTH2R (NP_005039.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTH2R |
| Target Synonyms | PTHR2; PTH2R | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-145 of human PTH2R (NP_005039.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY | Uniprot ID | P49190 |
Uniprot Id
P49190
Target Species
Human
Target Name
PTH2R
Target Full Name
Parathyroid hormone 2 receptor
Target Function
This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family
Target Tissue Specificity
Expressed abundantly in brain and pancreas. Also expressed in the testis.
Target Research Area
Neuroscience
Target Synonyms
Parathyroid hormone 2 receptor; Parathyroid hormone receptor precursor ; PTH 2 receptor ; PTH2 receptor; Pth2r; PTH2R_HUMAN; Pthr 2; Pthr2
Target Background
The protein encoded by this gene is a member of the G-protein coupled receptor 2 family. This protein is a receptor for parathyroid hormone (PTH). This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1). It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas. Alternative splicing results in multiple transcript variants.
Notification