-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXA9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human HOXA9 (NP_689952.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXA9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human HOXA9 (NP_689952.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04467A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXA9 |
| Target Synonyms | HOX1; ABD-B; HOX1G; HOX1.7; HOXA9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human HOXA9 (NP_689952.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPP | Uniprot ID | P31269 |
Uniprot Id
P31269
Target Species
Human
Target Name
HOXA9
Target Full Name
Homeobox protein Hox-A9
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Required for induction of E-selectin and VCAM-1, on the endothelial cells surface at sites of inflammation.
Target Involvement
A chromosomal aberration involving HOXA9 is found in a form of acute myeloid leukemia. Translocation t(7;11)(p15;p15) with NUP98.; DISEASE: Note=A chromosomal aberration involving HOXA9 may contribute to disease progression in chronic myeloid leukemia. Translocation t(7;17)(p15;q23) with MSI2.
Target Subcellular Location
Nucleus.
Target Protein Families
Abd-B homeobox family
Target Synonyms
ABD-B; Abd-B; drosophila; homolog of; D6a9; Homeobox 1G; Homeobox A9; Homeobox protein Hox-1.7; Homeobox protein Hox-1G; Homeobox protein Hox-A9; Homeodomain protein HOXA9; Hox-1.7; Hox-1.7; mouse; homolog of; HOX1; Hox1.7; Hox1G; Hox1r5; Hoxa-9; Hoxa7; HOXA9; HOXA9/MSI2 fusion gene; included; HOXA9/NUP98 fusion gene; included; HXA9_HUMAN; MGC1934
Target Background
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Read-through transcription exists between this gene and the upstream homeobox A10 (HOXA10) gene.
Notification