Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGRMC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human PGRMC2 (NP_006311.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PGRMC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human PGRMC2 (NP_006311.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04561A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGRMC2 |
| Target Synonyms | DG6; PMBP; PGRMC2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF-7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human PGRMC2 (NP_006311.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTG | Uniprot ID | O15173 |
Uniprot Id
O15173
Target Species
Human
Target Name
PGRMC2
Target Full Name
Membrane-associated progesterone receptor component 2
Target Function
Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan. May serve as a universal non-classical progesterone receptor in the uterus (Probable). Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus. Plays a role in adipocyte function and systemic glucose homeostasis. In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1.
Target Subcellular Location
Membrane; Single-pass membrane protein. Nucleus envelope. Endoplasmic reticulum.
Target Protein Families
Cytochrome b5 family, MAPR subfamily
Target Tissue Specificity
Expressed by endometrial glands and stroma (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
PGRMC2; DG6; PMBP; Membrane-associated progesterone receptor component 2; Progesterone membrane-binding protein; Steroid receptor protein DG6
Target Background
Enables heme binding activity. Involved in adipose tissue development. Located in endoplasmic reticulum and nuclear envelope.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
