-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXC8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human HOXC8 (NP_073149.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXC8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human HOXC8 (NP_073149.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05290A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXC8 |
| Target Synonyms | HOX3; HOX3A; HOXC8 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse spinal cord | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human HOXC8 (NP_073149.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRR | Uniprot ID | P31273 |
Uniprot Id
P31273
Target Species
Human
Target Name
HOXC8
Target Full Name
Homeobox protein Hox-C8
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family
Target Synonyms
Homeo box 3A; Homeo box 8; Homeobox 3A; Homeobox C8; Homeobox protein Hox C8; Homeobox protein Hox-3A; Homeobox protein Hox-C8; Homeobox protein HoxC8; Homeobox protein R4; Homolog of mouse Hox 3.1; HOX 3; Hox 3.1 mouse homolog of; HOX 3A; HOX C8; Hox-3.1; Hox-3A; HOX3; HOX3A; HOXC 8; Hoxc-8; HOXC8; HXC8_HUMAN; M31
Target Background
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders.
Notification