Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GALNT10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 444-603 of human GALNT10 (NP_938080.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GALNT10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 444-603 of human GALNT10 (NP_938080.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05378A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GALNT10 |
| Target Synonyms | GALNACT10; PPGALNACT10; PPGANTASE10; GALNT10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, Mouse brain, Mouse testis, OVCAR3, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 444-603 of human GALNT10 (NP_938080.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN | Uniprot ID | Q86SR1 |
Uniprot Id
Q86SR1
Target Species
Human
Target Name
GALNT10
Target Full Name
Polypeptide N-acetylgalactosaminyltransferase 10
Target Function
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward Muc5Ac and EA2 peptide substrates.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 2 family, GalNAc-T subfamily
Target Tissue Specificity
Widely expressed. Expressed at high level in small intestine, and at intermediate levels in stomach, pancreas, ovary, thyroid gland and spleen. Weakly expressed in other tissues.
Target Synonyms
DKFZp586H0623; FLJ00205; FLJ11715; GalNAc T10; GalNAc transferase 10; GalNAc-T10; GalNAcT10; GALNT10; GLT10_HUMAN; Polypeptide GalNAc transferase 10; Polypeptide N-acetylgalactosaminyltransferase 10; pp GalNAc T10; pp GaNTase 10; pp-GaNTase 10; ppGalNAcT10; ppGaNTase 10; Protein UDP acetylgalactosaminyltransferase 10; Protein-UDP acetylgalactosaminyltransferase 10; UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 10; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 10; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
