Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IMMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human IMMT (NP_006830.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against IMMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human IMMT (NP_006830.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05845A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IMMT |
| Target Synonyms | HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89; MICOS60; IMMT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse spleen, Mouse testis, NCI-H460, SW480, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human IMMT (NP_006830.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDD | Uniprot ID | Q16891 |
Uniprot Id
Q16891
Target Species
Human
Target Name
IMMT
Target Full Name
MICOS complex subunit MIC60
Target Function
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion.
Target Protein Families
MICOS complex subunit Mic60 family
Target Synonyms
IMMT; HMP; MIC60; MINOS2; PIG4; PIG52; MICOS complex subunit MIC60; Cell proliferation-inducing gene 4/52 protein; Mitochondrial inner membrane protein; Mitofilin; p87/89
Target Background
Enables RNA binding activity. Involved in cristae formation. Located in mitochondrial inner membrane. Part of MICOS complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
