Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDH15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human CDH15 (NP_004924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDH15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human CDH15 (NP_004924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06031A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDH15 |
| Target Synonyms | CDH3; CDHM; MCAD; MRD3; CDH14; CDH15 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human CDH15 (NP_004924.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYR | Uniprot ID | P55291 |
Uniprot Id
P55291
Target Species
Human
Target Name
CDH15
Target Full Name
Cadherin-15
Target Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. M-cadherin is part of the myogenic program and may provide a trigger for terminal muscle differentiation.
Target Involvement
Mental retardation, autosomal dominant 3 (MRD3)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in the brain and cerebellum.
Target Synonyms
CDH15; CDH14; CDH3; Cadherin-15; Cadherin-14; Muscle cadherin; M-cadherin
Target Background
This gene is a member of the cadherin superfamily of genes, encoding calcium-dependent intercellular adhesion glycoproteins. Cadherins consist of an extracellular domain containing 5 cadherin domains, a transmembrane region, and a conserved cytoplasmic domain. Transcripts from this particular cadherin are expressed in myoblasts and upregulated in myotubule-forming cells. The protein is thought to be essential for the control of morphogenetic processes, specifically myogenesis, and may provide a trigger for terminal muscle cell differentiation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
