Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP4R3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 628-817 of human PPP4R3B (NP_001269779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PPP4R3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 628-817 of human PPP4R3B (NP_001269779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06363A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP4R3B |
| Target Synonyms | PSY2; smk1; FLFL2; SMEK2; PP4R3B; PPP4R3B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 628-817 of human PPP4R3B (NP_001269779.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESSPRKRPRLGS | Uniprot ID | Q5MIZ7 |
Uniprot Id
Q5MIZ7
Target Species
Human
Target Name
PPP4R3B
Target Full Name
Serine/threonine-protein phosphatase 4 regulatory subunit 3B
Target Function
Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Note=In interphase localized in the cytoplasm and (with higher levels) the nucleus. During metaphase located in pericentriolar regions.
Target Protein Families
SMEK family
Target Tissue Specificity
Moderately expressed in tissues and specific brain regions examined.
Target Synonyms
PPP4R3B; KIAA1387; PP4R3B; SMEK2Serine/threonine-protein phosphatase 4 regulatory subunit 3B; SMEK homolog 2
Target Background
Predicted to act upstream of or within positive regulation of gluconeogenesis and protein dephosphorylation. Located in centrosome and nuclear speck.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
