-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNTN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CNTN1 (NP_778203.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CNTN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CNTN1 (NP_778203.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06879A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNTN1 |
| Target Synonyms | F3; GP135; MYPCN; CMYP12; CNTN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CNTN1 (NP_778203.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIPT | Uniprot ID | Q12860 |
Uniprot Id
Q12860
Target Species
Human
Target Name
CNTN1
Target Full Name
Contactin-1
Target Function
Contactins mediate cell surface interactions during nervous system development. Involved in the formation of paranodal axo-glial junctions in myelinated peripheral nerves and in the signaling between axons and myelinating glial cells via its association with CNTNAP1. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Interaction with TNR induces a repulsion of neurons and an inhibition of neurite outgrowth.
Target Involvement
Myopathy, congenital, Compton-North (MYPCN)
Target Subcellular Location
[Isoform 1]: Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side.; [Isoform 2]: Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side.
Target Protein Families
Immunoglobulin superfamily, Contactin family
Target Tissue Specificity
Strongly expressed in brain and in neuroblastoma and retinoblastoma cell lines. Lower levels of expression in lung, pancreas, kidney and skeletal muscle.
Target Synonyms
CNTN 1; CNTN; Cntn1; CNTN1_HUMAN; Contactin-1; Contactin1; F3; F3cam; Glycoprotein gp135; gp 135; GP135; MYPCN; Neural cell surface protein F3
Target Background
The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification