Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ST6GALNAC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human ST6GALNAC2 (NP_006447.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ST6GALNAC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human ST6GALNAC2 (NP_006447.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06975A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ST6GALNAC2 |
| Target Synonyms | STHM; SIAT7; SAITL1; SIAT7B; SIATL1; ST6GalNAII; ST6GALNAC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, K-562, Mouse lung, Mouse testis, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human ST6GALNAC2 (NP_006447.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFT | Uniprot ID | Q9UJ37 |
Uniprot Id
Q9UJ37
Target Species
Human
Target Name
ST6GALNAC2
Target Full Name
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
Target Function
Catalyzes the transfer of N-acetylneuraminyl groups onto glycan chains in glycoproteins.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 29 family
Target Tissue Specificity
Expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes.
Target Synonyms
ST6GALNAC2; SIAT7B; SIATL1; STHMAlpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; EC 2.4.99.3; GalNAc alpha-2,6-sialyltransferase II; ST6GalNAc II; ST6GalNAcII; SThM; Sialyltransferase 7B; SIAT7-B
Target Background
ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
