Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLXIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MLXIP (NP_055753.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MLXIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MLXIP (NP_055753.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06989A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLXIP |
| Target Synonyms | MIR; MONDOA; bHLHe36; MLXIP | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MLXIP (NP_055753.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARAHASAAPPPPRAGPGREEPPRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQTCQTYSFGKTSSCHLSIDASLTKLFECMTLAYSGKLVSPKWKNFK | Uniprot ID | Q9HAP2 |
Uniprot Id
Q9HAP2
Target Species
Human
Target Name
MLXIP
Target Full Name
MLX-interacting protein
Target Function
Binds DNA as a heterodimer with MLX and activates transcription. Binds to the canonical E box sequence 5'-CACGTG-3'. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation.
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion outer membrane.
Target Tissue Specificity
Widely expressed in adult tissues. Most abundant in skeletal muscle.
Target Research Area
Transcription
Target Synonyms
MLXIP; BHLHE36; KIAA0867; MIR; MONDOA; MLX-interacting protein; Class E basic helix-loop-helix protein 36; bHLHe36; Transcriptional activator MondoA
Target Background
This gene encodes a protein that functions as part of a heterodimer to activate transcription. The encoded protein forms a heterodimer with Max-like protein X (MLX) and is involved in the regulation of genes in response to cellular glucose levels.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
