Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHODL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human CHODL (NP_001191103.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHODL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human CHODL (NP_001191103.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07130A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHODL |
| Target Synonyms | MT75; PRED12; C21orf68; CHODL | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human CHODL (NP_001191103.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLL | Uniprot ID | Q9H9P2 |
Uniprot Id
Q9H9P2
Target Species
Human
Target Name
CHODL
Target Full Name
Chondrolectin
Target Function
May play a role in the development of the nervous system such as in neurite outgrowth and elongation. May be involved in motor axon growth and guidance.
Target Subcellular Location
Cytoplasm. Membrane; Single-pass type I membrane protein.; [Isoform 2]: Endoplasmic reticulum. Endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Isoform 3]: Cytoplasm.
Target Tissue Specificity
Found in spleen, testis, prostate and fetal liver. Expression limited to vascular muscle of testis, smooth muscle of prostate stroma, heart muscle, skeletal muscle, crypts of small intestine, and red pulp of spleen. B lymphocytes express isoform 2 only; p
Target Synonyms
C21orf68; Chodl; CHODL_HUMAN; Chondrolectin; Chromosome 21 open reading frame 68; FLJ12627; MT75; PRED12; Transmembrane protein MT75; UNQ872/PRO1890
Target Background
This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
