Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NIPSNAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human NIPSNAP1 (NP_003625.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NIPSNAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human NIPSNAP1 (NP_003625.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07171A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NIPSNAP1 |
| Target Synonyms | NIPSNAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29, Mouse brain, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human NIPSNAP1 (NP_003625.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNN | Uniprot ID | Q9BPW8 |
Uniprot Id
Q9BPW8
Target Species
Human
Target Name
NIPSNAP1
Target Full Name
Protein NipSnap homolog 1
Target Synonyms
NIPSNAP1; Protein NipSnap homolog 1; NipSnap1
Target Background
This gene encodes a member of the NipSnap family of proteins that may be involved in vesicular transport. A similar protein in mice inhibits the calcium channel TRPV6, and is also localized to the inner mitochondrial membrane where it may play a role in mitochondrial DNA maintenance. A pseudogene of this gene is located on the short arm of chromosome 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
