Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRAF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human PRAF2 (NP_009144.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRAF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human PRAF2 (NP_009144.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07292A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRAF2 |
| Target Synonyms | JM4; Yip6a; PRAF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, Mouse brain, Mouse lung, Rat lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human PRAF2 (NP_009144.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLL | Uniprot ID | O60831 |
Uniprot Id
O60831
Target Species
Human
Target Name
PRAF2
Target Full Name
PRA1 family protein 2
Target Function
May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptotic role in cerulenin-induced neuroblastoma apoptosis.
Target Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Target Protein Families
PRA1 family
Target Tissue Specificity
Strong expression in the brain, small intestine, lung, spleen, and pancreas as well as in tumor tissues of the breast, colon, lung and ovary, with a weaker expression in normal tissues of the same patient. High expression in neuroblastic tumors. Strongly
Target Synonyms
PRAF2; JM4; PRA1 family protein 2
Target Background
Predicted to be involved in L-glutamate transmembrane transport. Predicted to be located in endosome membrane. Predicted to be integral component of membrane. Predicted to be active in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
