Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MFGE8 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 231-387 of human MFGE8(NP_005919.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against MFGE8 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 231-387 of human MFGE8(NP_005919.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of?U-2 OS cells using?MFGE8 Rabbit pAb(A25171) at?a?dilution of?1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.?Blue: DAPI for nuclear staining.
| Cat.No | ADA-08446A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MFGE8 |
| Target Synonyms | BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888; MFGE8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 231-387 of human MFGE8(NP_005919.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC | Uniprot ID | Q08431 |
Uniprot Id
Q08431
Target Species
Human
Target Name
MFGE8
Target Full Name
Lactadherin
Target Function
Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction.; Main constituent of aortic medial amyloid.
Target Subcellular Location
Membrane; Peripheral membrane protein. Secreted. Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Peripheral membrane protein.
Target Tissue Specificity
Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
Target Synonyms
BA46; Breast epithelial antigen BA46; EDIL1; HMFG; hP47; HsT19888; Lactadherin; Medin; MFG-E8; MFGE8; MFGM; MFGM_HUMAN; Milk fat globule EGF factor 8; Milk fat globule EGF factor 8 protein; Milk fat globule-EGF factor 8; O acetyl disialoganglioside synthase; OAcGD3S; SED1; SPAG10; Sperm associated antigen 10; Sperm surface protein hP47
Target Background
This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
