-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MGAT4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-100 of human MGAT4A (NP_036346.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MGAT4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-100 of human MGAT4A (NP_036346.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08647A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MGAT4A |
| Target Synonyms | GNT-IV; GnT-4a; GNT-IVA; MGAT4A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, K562, LO2, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-100 of human MGAT4A (NP_036346.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFKRVGAETNGSKDALNKFSDNTLKLLKELTSK | Uniprot ID | Q9UM21 |
Uniprot Id
Q9UM21
Target Species
Human
Target Name
MGAT4A
Target Full Name
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
Target Function
Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells.
Target Subcellular Location
[Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A]: Golgi apparatus membrane; Single-pass type II membrane protein.; [Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form]: Secreted.
Target Protein Families
Glycosyltransferase 54 family
Target Tissue Specificity
Expressed in pancreas, spleen, thymus, prostate, small intestine, peripheral blood leukocytes and lymph node. Strongly overexpressed in choriocarcinoma cancer cell lines. Down-regulated in pancreatic cancer.
Target Research Area
Metabolism
Target Synonyms
3-D-mannoside beta-1; 3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form; 4-N-acetylglucosaminyltransferase IVa; Alpha-1; GlcNAc T IVa; GlcNAc-T IVa; GNT IV; GNT IVA; GnT-IVa; GNTIV; GNTIVA; MGAT 4A; MGAT4A; MGT4A_HUMAN; N acetylglucosaminyltransferase Iva; N-acetylglucosaminyltransferase IVa; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa; UDP-N-acetylglucosamine: alpha-1
Target Background
This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1, 4 linkage to the Man-alpha-1, 3-Man-beta-1, 4-GlcNAc arm of R-Man-alpha-1, 6(GlcNAc-beta-1, 2-Man-alpha-1, 3)Man-beta-1, 4-GlcNAc-beta-1, 4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation.
Notification