-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCR7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-372 of human CCR7 (NP_001829.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CCR7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-372 of human CCR7 (NP_001829.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08830A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCR7 |
| Target Synonyms | BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7; CCR7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 330-372 of human CCR7 (NP_001829.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAET | Uniprot ID | P32248 |
Uniprot Id
P32248
Target Species
Human
Target Name
CCR7
Target Full Name
C-C chemokine receptor type 7
Target Function
Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.
Target Research Area
Others
Target Synonyms
CCR7; CMKBR7; EBI1; EVI1; C-C chemokine receptor type 7; C-C CKR-7; CC-CKR-7; CCR-7; BLR2; CDw197; Epstein-Barr virus-induced G-protein coupled receptor 1; EBV-induced G-protein coupled receptor 1; MIP-3 beta receptor; CD antigen CD197
Target Background
The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants.
Notification