-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CTNS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CTNS (NP_001026851.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CTNS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CTNS (NP_001026851.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09415A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CTNS |
| Target Synonyms | PQLC4; SLC66A4; CTNS-LSB; CTNS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, HepG2, Mouse skeletal muscle, Rat kidney, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CTNS (NP_001026851.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRS | Uniprot ID | O60931 |
Uniprot Id
O60931
Target Species
Human
Target Name
CTNS
Target Full Name
Cystinosin
Target Function
Cystine/H(+) symporter that mediates export of cystine, the oxidized dimer of cysteine, from lysosomes. Plays an important role in melanin synthesis by catalyzing cystine export from melanosomes, possibly by inhibiting pheomelanin synthesis. In addition to cystine export, also acts as a positive regulator of mTORC1 signaling in kidney proximal tubular cells, via interactions with components of the v-ATPase and Ragulator complexes. Also involved in small GTPase-regulated vesicle trafficking and lysosomal localization of LAMP2A, independently of cystine transporter activity.
Target Involvement
Cystinosis, nephropathic type (CTNS); Cystinosis, adult, non-nephropathic type (CTNSANN); Cystinosis, late-onset juvenile or adolescent nephropathic type (CTNSJAN)
Target Subcellular Location
[Isoform 1]: Lysosome membrane; Multi-pass membrane protein. Melanosome membrane; Multi-pass membrane protein.; [Isoform 2]: Lysosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Cystinosin family
Target Tissue Specificity
Strongly expressed in pancreas, kidney (adult and fetal), skeletal muscle, melanocytes and keratinocytes. Expressed at lower levels in placenta and heart. Weakly expressed in lung, liver and brain (adult and fetal).; [Isoform 2]: Represents 5-20 % of CTNS
Target Synonyms
CTNS; Cystinosin
Target Background
This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.
Notification