-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TDG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TDG (NP_003202.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TDG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TDG (NP_003202.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09649A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TDG |
| Target Synonyms | hTDG; TDG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TDG (NP_003202.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW | Uniprot ID | Q13569 |
Uniprot Id
Q13569
Target Species
Human
Target Name
TDG
Target Full Name
G/T mismatch-specific thymine DNA glycosylase
Target Function
DNA glycosylase that plays a key role in active DNA demethylation: specifically recognizes and binds 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) in the context of CpG sites and mediates their excision through base-excision repair (BER) to install an unmethylated cytosine. Cannot remove 5-hydroxymethylcytosine (5hmC). According to an alternative model, involved in DNA demethylation by mediating DNA glycolase activity toward 5-hydroxymethyluracil (5hmU) produced by deamination of 5hmC. Also involved in DNA repair by acting as a thymine-DNA glycosylase that mediates correction of G/T mispairs to G/C pairs: in the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. Its role in the repair of canonical base damage is however minor compared to its role in DNA demethylation. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine.
Target Subcellular Location
Nucleus.
Target Protein Families
Uracil-DNA glycosylase (UDG) superfamily, TDG/mug family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
C JUN leucine zipper interactive protein; C JUN leucine zipper interactive protein; C-JUN leucine zipper interactive protein JZA-3; E130317C12Rik; EC 3.2.2.29; G/T mismatch specific thymine DNA glycosylase; G/T mismatch specific thymine DNA glycosylase; G/T mismatch-specific thymine DNA glycosylase; JZA 3; Jza1; T:G mismatch thymine glycosylase; Tdg; TDG_HUMAN; Thymine DNA glycosylase; Thymine-DNA glycosylase
Target Background
The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaired thymine. With lower activity, this enzyme also removes thymine from C/T and T/T mispairings. TDG can also remove uracil and 5-bromouracil from mispairings with guanine. This enzyme plays a central role in cellular defense against genetic mutation caused by the spontaneous deamination of 5-methylcytosine and cytosine. This gene may have a pseudogene in the p arm of chromosome 12.
Notification