-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bcl2(Isoform Beta) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-199 of mouse Bcl2(Isoform Beta) (NP_803129.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Bcl2(Isoform Beta) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-199 of mouse Bcl2(Isoform Beta) (NP_803129.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10568A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Bcl2(Isoform Beta) |
| Target Synonyms | Bcl-2; C430015F12Rik; D630044D05Rik; D830018M01Rik; Bcl2(Isoform Beta) | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-199 of mouse Bcl2(Isoform Beta) (NP_803129.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | FGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGACLVE | Uniprot ID | P10417 |
Uniprot Id
P10417
Target Species
Mouse
Target Name
BCL2
Target Full Name
Apoptosis regulator Bcl-2
Target Function
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
Bcl-2 family
Target Tissue Specificity
Expressed in a variety of tissues.
Target Synonyms
Bcl-2; C430015F12Rik; D630044D05Rik; D830018M01Rik; Bcl2(Isoform Beta)
Target Background
This gene encodes a member of the B cell lymphoma 2 protein family. Members of this family regulate cell death in multiple cell types and can have either proapoptotic or antiapoptotic activities. The protein encoded by this gene inhibits mitochondrial-mediated apoptosis. This protein is an integral outer mitochondrial membrane protein that functions as part of signaling pathway that controls mitochondrial permeability in response to apoptotic stimuli. This protein may also play a role in neuron cell survival and autophagy. Abnormal expression and chromosomal translocations of this gene are associated with cancer progression in numerous tissues. Alternate splicing results in multiple transcript variants.
Notification