Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC34A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 234-362 of human SLC34A2 (NP_001171469.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC34A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 234-362 of human SLC34A2 (NP_001171469.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10871A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC34A2 |
| Target Synonyms | PULAM; NPTIIb; NaPi2b; NAPI-3B; NAPI-IIb; SLC34A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, HT-29, MCF7, Mouse small intestine, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 234-362 of human SLC34A2 (NP_001171469.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA | Uniprot ID | O95436 |
Uniprot Id
O95436
Target Species
Human
Target Name
SLC34A2
Target Full Name
Sodium-dependent phosphate transport protein 2B
Target Function
May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Target Involvement
Pulmonary alveolar microlithiasis (PALM)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
SLC34A transporter family
Target Tissue Specificity
Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium.
Target Research Area
Signal Transduction
Target Synonyms
SLC34A2; Sodium-dependent phosphate transport protein 2B; Sodium-phosphate transport protein 2B; Na(+)-dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na(+)/Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2
Target Background
The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
