-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2M was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human UBE2M (NP_003960.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2M was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human UBE2M (NP_003960.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10879A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2M |
| Target Synonyms | UBC12; hUbc12; UBC-RS2; UBE2M | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, 293T, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human UBE2M (NP_003960.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK | Uniprot ID | P61081 |
Uniprot Id
P61081
Target Species
Human
Target Name
UBE2M
Target Full Name
NEDD8-conjugating enzyme Ubc12
Target Function
Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation.
Target Protein Families
Ubiquitin-conjugating enzyme family, UBC12 subfamily
Target Synonyms
hUbc12; NEDD8 carrier protein; NEDD8 conjugating enzyme Ubc12; NEDD8 protein ligase; NEDD8-conjugating enzyme Ubc12; UBC-RS2; UBC12; UBC12_HUMAN; ube2m; ubiquitin carrier protein M; Ubiquitin conjugating enzyme E2 M; Ubiquitin-conjugating enzyme E2 M; ubiquitin-protein ligase M; yeast UBC12 homolog
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin.
Notification