-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPCN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 11-85 of human TPCN2 (NP_620714.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TPCN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 11-85 of human TPCN2 (NP_620714.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPCN2 |
| Target Synonyms | TPC2; SHEP10; TPCN2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 11-85 of human TPCN2 (NP_620714.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRT | Uniprot ID | Q8NHX9 |
Uniprot Id
Q8NHX9
Target Species
Human
Target Name
TPCN2
Target Full Name
Two pore channel protein 2
Target Function
Intracellular channel initially characterized as a non-selective Ca(2+)-permeable channel activated by NAADP (nicotinic acid adenine dinucleotide phosphate), it is also a highly-selective Na(+) channel activated directly by PI(3,5)P2 (phosphatidylinositol 3,5-bisphosphate). Localizes to the lysosomal and late endosome membranes where it regulates organellar membrane excitability, membrane trafficking, and pH homeostasis. Is associated with a plethora of physiological processes, including mTOR-dependent nutrient sensing, skin pigmentation and autophagy (Probable). Ion selectivity is not fixed but rather agonist-dependent and under defined ionic conditions, can be readily activated by both NAADP and PI(3,5)P2. As calcium channel, it increases the pH in the lysosomal lumen, as sodium channel, it promotes lysosomal exocytosis. Plays a crucial role in endolysosomal trafficking in the endolysosomal degradation pathway and is potentially involved in the homeostatic control of many macromolecules and cell metabolites. Unlike the voltage-dependent TPCN1, TPCN2 is voltage independent and can be activated solely by PI(3,5)P2 binding. In contrast, PI(4,5)P2, PI(3,4)P2, PI(3)P and PI(5)P have no obvious effect on channel activation.; (Microbial infection) During Ebola virus (EBOV) infection, controls the movement of endosomes containing virus particles and is required by EBOV to escape from the endosomal network into the cell cytoplasm.; (Microbial infection) Required for cell entry of coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus EMC (HCoV-EMC), by endocytosis
Target Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Target Protein Families
Calcium channel alpha-1 subunit (TC 1.A.1.11) family, Two pore calcium channel subfamily
Target Tissue Specificity
Widely expressed. Expressed at high level in liver and kidney.
Target Synonyms
SHEP10; TPC2; TPC2_HUMAN; tpcn2; Two pore calcium channel protein 2; two pore segment channel 2; Two-pore channel 2; Voltage dependent calcium channel protein TPC2; Voltage-dependent calcium channel protein TPC2
Notification