-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08909A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCB4 |
| Target Synonyms | GBD1; ICP3; MDR2; MDR3; PGY3; ABC21; MDR2/3; PFIC-3; ABCB4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILE | Uniprot ID | P21439 |
Uniprot Id
P21439
Target Species
Human
Target Name
ABCB4
Target Full Name
Phosphatidylcholine translocator ABCB4
Target Function
Energy-dependent phospholipid efflux translocator that acts as a positive regulator of biliary lipid secretion. Functions as a floppase that translocates specifically phosphatidylcholine (PC) from the inner to the outer leaflet of the canalicular membrane bilayer into the canaliculi of hepatocytes. Translocation of PC makes the biliary phospholipids available for extraction into the canaliculi lumen by bile salt mixed micelles and therefore protects the biliary tree from the detergent activity of bile salts. Plays a role in the recruitment of phosphatidylcholine (PC), phosphatidylethanolamine (PE) and sphingomyelin (SM) molecules to nonraft membranes and to further enrichment of SM and cholesterol in raft membranes in hepatocytes. Required for proper phospholipid bile formation. Indirectly involved in cholesterol efflux activity from hepatocytes into the canalicular lumen in the presence of bile salts in an ATP-dependent manner. Promotes biliary phospholipid secretion as canaliculi-containing vesicles from the canalicular plasma membrane. In cooperation with ATP8B1, functions to protect hepatocytes from the deleterious detergent activity of bile salts. Does not confer multidrug resistance.
Target Involvement
Cholestasis, progressive familial intrahepatic, 3 (PFIC3); Cholestasis of pregnancy, intrahepatic 3 (ICP3); Gallbladder disease 1 (GBD1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Membrane raft. Cytoplasm. Cytoplasmic vesicle, clathrin-coated vesicle.
Target Protein Families
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Target Synonyms
ABC 21; ABC B4; ABC21; ABCB 4; Abcb4; ABCB4 protein; ATP binding cassette sub family B MDR/TAP member 4; ATP binding cassette sub family B member 4; ATP-binding cassette sub-family B member 4; GBD1; ICP3; MDR 3; MDR2; MDR2/3; MDR3; MDR3 P glycoprotein; MDR3 P gp; MDR3_HUMAN; Multidrug resistance protein 3; Multiple drug resistance 3; P glycoprotein 3 ; P-glycoprotein 3; PFIC 3; PFIC3; PGY 3; PGY3
Target Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function.
Notification