-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG1 (NP_004906.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG1 (NP_004906.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15932A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCG1 |
| Target Synonyms | ABC8; WHITE1; ABCG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Hep G2, Mouse liver, Mouse thymus, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG1 (NP_004906.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEI | Uniprot ID | P45844 |
Uniprot Id
P45844
Target Species
Human
Target Name
ABCG1
Target Full Name
ATP-binding cassette sub-family G member 1
Target Function
Catalyzes the efflux of phospholipids such as sphingomyelin, cholesterol and its oxygenated derivatives like 7beta-hydroxycholesterol and this transport is coupled to hydrolysis of ATP. The lipid efflux is ALB-dependent. Is an active component of the macrophage lipid export complex. Could also be involved in intracellular lipid transport processes. The role in cellular lipid homeostasis may not be limited to macrophages. Prevents cell death by transporting cytotoxic 7beta-hydroxycholesterol.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane. Note=Predominantly localized in the intracellular compartments mainly associated with the endoplasmic reticulum (ER) and Golgi membranes.
Target Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Target Tissue Specificity
Expressed in several tissues. Expressed in macrophages; expression is increased in macrophages from patients with Tangier disease.
Target Research Area
Cancer
Target Synonyms
ABCG1; ABC8; WHT1; ATP-binding cassette sub-family G member 1; ATP-binding cassette transporter 8; White protein homolog
Target Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.
Notification