Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABHD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-342 of human ABHD4 (NP_071343.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ABHD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-342 of human ABHD4 (NP_071343.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07073A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABHD4 |
| Target Synonyms | ABH4; ABHD4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 223-342 of human ABHD4 (NP_071343.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD | Uniprot ID | Q8TB40 |
Uniprot Id
Q8TB40
Target Species
Human
Target Name
ABHD4
Target Full Name
(Lyso)-N-acylphosphatidylethanolamine lipase
Target Function
Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine.
Target Protein Families
Peptidase S33 family, ABHD4/ABHD5 subfamily
Target Synonyms
ABHD4(Lyso)-N-acylphosphatidylethanolamine lipase; EC 3.1.1.-; Alpha/beta hydrolase domain-containing protein 4; Abhydrolase domain-containing protein 4; Alpha/beta-hydrolase 4
Target Background
Predicted to enable lysophosphatidic acid acyltransferase activity and lysophospholipase activity. Predicted to be involved in N-acylphosphatidylethanolamine metabolic process; lipid homeostasis; and phosphatidic acid biosynthetic process. Predicted to act upstream of or within N-acylethanolamine metabolic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in lipid droplet and mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
