Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AHNAK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human AHNAK (NP_001611.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against AHNAK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human AHNAK (NP_001611.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of AHNAK in paraffin-embedded Mouse liver using AHNAK Rabbit pAb at dilution of 1:50 (40x lens).1.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-06789A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AHNAK |
| Target Synonyms | PM227; AHNAK1; AHNAKRS; AHNAK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human AHNAK (NP_001611.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLSGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSR | Uniprot ID | Q09666 |
Uniprot Id
Q09666
Target Species
Human
Target Name
AHNAK
Target Full Name
Neuroblast differentiation-associated protein AHNAK
Target Function
May be required for neuronal cell differentiation.
Target Subcellular Location
Nucleus.
Target Synonyms
AHNAK; AHNAK nucleoprotein (desmoyokin); AHNAK nucleoprotein; AHNAKRS; AHNK_HUMAN; Desmoyokin; Fragments; MGC5395; Neuroblast differentiation associated protein AHNAK; Neuroblast differentiation-associated protein AHNAK; PM227
Target Background
The protein encoded by this gene is a large (700 kDa) structural scaffold protein consisting of a central domain with 128 aa repeats. The encoded protein may play a role in such diverse processes as blood-brain barrier formation, cell structure and migration, cardiac calcium channel regulation, and tumor metastasis. A much shorter variant encoding a 17 kDa isoform exists for this gene, and the shorter isoform initiates a feedback loop that regulates alternative splicing of this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
