Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AJAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human AJAP1 (NP_061324.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AJAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human AJAP1 (NP_061324.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02472A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AJAP1 |
| Target Synonyms | MOT8; SHREW1; SHREW-1; AJAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AJAP1 (NP_061324.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVA | Uniprot ID | Q9UKB5 |
Uniprot Id
Q9UKB5
Target Species
Human
Target Name
AJAP1
Target Full Name
Adherens junction-associated protein 1
Target Function
Plays a role in cell adhesion and cell migration.
Target Subcellular Location
Basolateral cell membrane; Single-pass type III membrane protein. Apical cell membrane; Single-pass type III membrane protein. Cell junction, adherens junction. Note=Mainly basolateral. Localization is mediated by AP1M2.
Target Tissue Specificity
Expressed in uterus and pancreas (at protein level).
Target Synonyms
Adherens junction-associated protein 1; Ajap1; AJAP1_HUMAN; Membrane protein shrew-1; MOT8; SHREW-1; SHREW1; Transmembrane protein SHREW1
Target Background
Enables beta-catenin binding activity. Involved in negative regulation of cell-matrix adhesion; negative regulation of wound healing; and regulation of polarized epithelial cell differentiation. Located in several cellular components, including adherens junction; basolateral plasma membrane; and cell-cell contact zone. Is spanning component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
