Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANGPTL8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-198 of human ANGPTL8 (NP_061157.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANGPTL8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-198 of human ANGPTL8 (NP_061157.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02883A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Angptl8 |
| Target Synonyms | RIFL; TD26; PRO1185; PVPA599; C19orf80; ANGPTL8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, THP-1(Negative control) | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-198 of human ANGPTL8 (NP_061157.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA | Uniprot ID | Q6UXH0 |
Uniprot Id
Q6UXH0
Target Species
Human
Target Name
ANGPTL8
Target Full Name
Angiopoietin-like protein 8
Target Function
Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels. May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state.
Target Involvement
Diabetes mellitus, insulin-dependent (IDDM); Diabetes mellitus, non-insulin-dependent (NIDDM)
Target Subcellular Location
Secreted.
Target Protein Families
ANGPTL8 family
Target Tissue Specificity
Predominantly expressed in liver. Also expressed in adipose tissues.
Target Research Area
Cell Biology
Target Synonyms
ANGPTL8; C19orf80; RIFL; UNQ599/PRO1185Angiopoietin-like protein 8; Betatrophin; Lipasin; Refeeding-induced fat and liver protein
Target Background
Predicted to enable hormone activity. Involved in regulation of lipid metabolic process and triglyceride homeostasis. Acts upstream of or within positive regulation of protein processing and regulation of lipoprotein metabolic process. Located in extracellular region.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
