-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANKRD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human ANKRD2 (NP_001123453.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANKRD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human ANKRD2 (NP_001123453.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03920A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANKRD2 |
| Target Synonyms | ARPP; ANKRD2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human ANKRD2 (NP_001123453.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP | Uniprot ID | Q9GZV1 |
Uniprot Id
Q9GZV1
Target Species
Human
Target Name
ANKRD2
Target Full Name
Ankyrin repeat domain-containing protein 2
Target Function
Functions as a negative regulator of myocyte differentiation. May interact with both sarcoplasmic structural proteins and nuclear proteins to regulate gene expression during muscle development and in response to muscle stress.
Target Subcellular Location
Cytoplasm, myofibril, sarcomere, I band. Cytoplasm, cytosol. Nucleus. Nucleus, PML body. Note=In the sarcoplasm of differentiated striated muscle cells, where it is cytosolic and enriched in the I band. In nucleus and PML bodies of proliferating and undifferentiated myoblasts. Associates with the euchromatin in the nucleus of myocytes upon muscle stress.
Target Tissue Specificity
Mostly expressed in skeletal and cardiac muscles. Found in slow fibers. Also expressed in kidney, but to a lower extent (at protein level).
Target Synonyms
ANKRD2; ARPPAnkyrin repeat domain-containing protein 2; Skeletal muscle ankyrin repeat protein; hArpp
Target Background
This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification