-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP1S1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human AP1S1 (NP_001274.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AP1S1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human AP1S1 (NP_001274.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06418A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP1S1 |
| Target Synonyms | AP19; EKV3; CLAPS1; MEDNIK; SIGMA1A; AP1S1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human AP1S1 (NP_001274.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG | Uniprot ID | P61966 |
Uniprot Id
P61966
Target Species
Human
Target Name
AP1S1
Target Full Name
AP-1 complex subunit sigma-1A
Target Function
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Target Involvement
Mental retardation, enteropathy, deafness, peripheral neuropathy, ichthyosis, and keratoderma (MEDNIK)
Target Subcellular Location
Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, clathrin-coated pit. Note=Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Target Protein Families
Adaptor complexes small subunit family
Target Tissue Specificity
Widely expressed.
Target Synonyms
Adapter related protein complex 1 sigma 1A subunit; Adapter-related protein complex 1 sigma-1A subunit; Adaptor protein complex AP-1 sigma-1A subunit; Adaptor protein complex AP1 sigma 1A subunit; AP-1 complex subunit sigma-1A; AP1 complex subunit sigma 1A; AP19; AP1S1; AP1S1_HUMAN; CLAPS1; Clathrin assembly protein complex 1 sigma 1A small chain; Clathrin assembly protein complex 1 sigma-1A small chain; Clathrin coat assembly protein AP19; Golgi adaptor HA1/AP1 adaptin sigma 1A subunit; Golgi adaptor HA1/AP1 adaptin sigma-1A subunit; HA1 19 kDa subunit; Sigma 1a subunit of AP-1 clathrin; Sigma 1a subunit of AP1 clathrin; Sigma adaptin 1A; Sigma-adaptin 1A; Sigma1A adaptin; Sigma1A-adaptin
Target Background
The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle.
Notification