-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP3S2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human AP3S2 (NP_005820.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AP3S2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human AP3S2 (NP_005820.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06967A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP3S2 |
| Target Synonyms | AP3S3; sigma3b; AP3S2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HT-29, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human AP3S2 (NP_005820.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV | Uniprot ID | P59780 |
Uniprot Id
P59780
Target Species
Human
Target Name
AP3S2
Target Full Name
AP-3 complex subunit sigma-2
Target Function
Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.
Target Subcellular Location
Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Adaptor complexes small subunit family
Target Tissue Specificity
Present in all adult tissues examined.
Target Synonyms
Adapter related protein complex 3 sigma 2 subunit; Adapter-related protein complex 3 sigma-2 subunit; AP 3 complex sigma 3B subunit; AP-3 complex subunit sigma-2; AP-3 complex subunit sigma-3B; Ap3s2; AP3S2_HUMAN; Clathrin adaptor complex AP3 sigma 3b subunit; Clathrin associated/assembly/adaptor protein; small 4 22-kD; Sigma 3B adaptin; Sigma adaptin 3b; Sigma-3B-adaptin; Sigma-adaptin 3b; Sigma3B-adaptin
Target Background
Predicted to be involved in anterograde synaptic vesicle transport and vesicle-mediated transport. Located in intracellular membrane-bounded organelle. Part of AP-3 adaptor complex.
Notification