-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APOC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human APOC2 (NP_000474.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against APOC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human APOC2 (NP_000474.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04510A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOC2 |
| Target Synonyms | APO-CII; APOC-II; APOC2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver, Rat plasma | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human APOC2 (NP_000474.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE | Uniprot ID | P02655 |
Uniprot Id
P02655
Target Species
Human
Target Name
APOC2
Target Full Name
Apolipoprotein C-II
Target Function
Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.
Target Involvement
Hyperlipoproteinemia 1B (HLPP1B)
Target Subcellular Location
Secreted.
Target Protein Families
Apolipoprotein C2 family
Target Tissue Specificity
Liver and intestine.
Target Research Area
Metabolism
Target Synonyms
APC 2; APC2; Apo CII; Apo-CII; APOC 2; ApoC II; ApoC-II; APOC2; APOC2 protein; APOC2_HUMAN; ApoCII; Apolipoprotein C II; Apolipoprotein C II precursor; Apolipoprotein C2; ApolipoproteinCII; MGC75082; ProapoC-II; Proapolipoprotein C-II
Target Background
This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene.
Notification