-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Aromatase (CYP19A1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Aromatase (CYP19A1) (NP_000094.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Aromatase (CYP19A1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Aromatase (CYP19A1) (NP_000094.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12638A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Aromatase (CYP19A1) |
| Target Synonyms | ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM; Aromatase (CYP19A1) | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Aromatase (CYP19A1) (NP_000094.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN | Uniprot ID | P11511 |
Uniprot Id
P11511
Target Species
Human
Target Name
CYP19A1
Target Full Name
Aromatase
Target Function
A cytochrome P450 monooxygenase that catalyzes the conversion of C19 androgens, androst-4-ene-3,17-dione (androstenedione) and testosterone to the C18 estrogens, estrone and estradiol, respectively. Catalyzes three successive oxidations of C19 androgens: two conventional oxidations at C19 yielding 19-hydroxy and 19-oxo/19-aldehyde derivatives, followed by a third oxidative aromatization step that involves C1-beta hydrogen abstraction combined with cleavage of the C10-C19 bond to yield a phenolic A ring and formic acid. Alternatively, the third oxidative reaction yields a 19-norsteroid and formic acid. Converts dihydrotestosterone to delta1,10-dehydro 19-nordihydrotestosterone and may play a role in homeostasis of this potent androgen. Also displays 2-hydroxylase activity toward estrone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Target Involvement
Aromatase excess syndrome (AEXS); Aromatase deficiency (AROD)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Target Protein Families
Cytochrome P450 family
Target Tissue Specificity
Widely expressed, including in adult and fetal brain, placenta, skin fibroblasts, adipose tissue and gonads.
Target Research Area
Cancer
Target Synonyms
ARO; ARO1; Aromatase; CP19A_HUMAN; CPV1; CYAR; CYP19; Cyp19a1; CYPXIX; Cytochrome P-450AROM; Cytochrome P450 19A1; Cytochrome P450; family 19; subfamily A; polypeptide 1; Cytochrome P450; subfamily XIX (aromatization of androgens); Estrogen synthase; Estrogen synthetase; Flavoprotein linked monooxygenase; MGC104309; Microsomal monooxygenase; OTTHUMP00000162543; OTTHUMP00000198350; P 450AROM
Target Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
Notification